PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G17810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 312aa    MW: 33276.4 Da    PI: 4.4319
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G17810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.77.8e-11152208460
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      +k+ rr  +NR +A +sR+RKk++++ Le+k+k Leae ++L   l+  + e  +l+
  LPERR06G17810.1 152 SKKKRRQLRNRDSAMKSRERKKMYVKDLETKSKYLEAECRRLSYALQCCTAENMALR 208
                      699*************************************99988877666666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.6E-7148213IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-12149212No hitNo description
PROSITE profilePS502179.749151214IPR004827Basic-leucine zipper domain
PfamPF001707.5E-10153209IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.38E-11153211No hitNo description
CDDcd147041.00E-14154205No hitNo description
PROSITE patternPS000360156171IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MDAAAAVVGD AEFFADLDLD ALLASFSAAD SGVSGLFAPS PHDAAAAAAA GSPESVSSRM  60
SPTREGALLD IERFLMEEGP EAGAEVEEGV GVEDFFDALI VDGGEGEREE EEGKGSEAGG  120
STDGDSGKEN EVATPDAEKE EVEEIDGDDP ISKKKRRQLR NRDSAMKSRE RKKMYVKDLE  180
TKSKYLEAEC RRLSYALQCC TAENMALRQS LLKDRPVGAA TAMQESAVLT ETLPLVSLLW  240
LVSIVCLLLM PGLPNRNPVA RSSAGRDLVM VTGKKTSGEQ LETLELLGRR CKGSRARIKI  300
YTGPFHAAAA AC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152156KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070210.0AK107021.1 Oryza sativa Japonica Group cDNA clone:002-121-A01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657145.11e-142PREDICTED: bZIP transcription factor 60
TrEMBLA0A0D9WS830.0A0A0D9WS83_9ORYZ; Uncharacterized protein
STRINGOB06G29280.11e-142(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.15e-12basic region/leucine zipper motif 60